130091-BIOTIN

Myostatin (MSTN, Growth Differentiation Factor 8, Growth/Differentiation Factor 8, GDF8, GDF-8) (Biotin)

Size

£914.00

SKU:: 130091-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa243-310 from human GDF8 (NP_005250) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: GDF-8, also known as Myostatin, belongs to the TGF-beta superfamily. It is synthesized as an inactive proprotein with the N-terminal pro-region and the C-terminal mature bioactive region. The GDF-8 proregion is capable of associating with active GDF-8 with high affinity and is a potent GDF-8 antagonist. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCS Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.