Myoglobin (MB)

Size

£685.00

SKU:: 130087
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-100 from human MB (NP_005359.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Myoglobin is a cytoplasmic single chain polypeptide that contains a single heme group and functions as an oxygen transporting pigment. It is found in skeletal and cardiac muscle but not smooth muscle. This antibody does not recognize hemoglobin and may help in detecting tissues of striated muscle origin. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKI Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.