MYO3A (Myosin-IIIa)

Size

£685.00

SKU:: 130074
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1400-1490 from human MYO3A (NP_059129) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8D12
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Probable actin-based motor with a protein kinase activity. Probably plays a role in vision and hearing. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HEEINNIKKKDNKDSKATSEREACGLAIFSKQISKLSEEYFILQKKLNEMILSQQLKSLYLGVSHHKPINRRVSSQQCLSGVCKGEEPKIL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.