130061
MYL7 (Myosin Regulatory Light Chain 2, Atrial Isoform, MLC-2a, MLC2a, Myosin Light Chain 2a, Myosin Regulatory Light Chain 7, MYL2A, MYLC2A)
Size
£685.00
- SKU:
- 130061
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human MYL7, aa1-175 (NP_067046.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- MYL7 protein is a atrial isoform of myosin regulatory light chain 2(MYL2). Myosin is an hexamer of 2 heavy chains and 4 light chains. MYL7 is predominantly expressed in adult atrial muscle. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice