130058
MYL5 (Myosin Light Chain 5, Myosin Regulatory Light Chain 5, Superfast Myosin Regulatory Light Chain 2, MYLC2, MyLC-2)
Size
£760.00
- SKU:
- 130058
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human MYL5, aa1-173 (NP_002468.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Myosin regulatory light chain 5, also known as MYL5, is a hexameric ATPase cellular motor protein. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL5 is a regulatory light chain and is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. Reconstitution of myosin with regulatory light chain 5 or alkali light chain increases filament velocity to intermediate rates, and readdition of both classes of light chains fully restores the original sliding velocity. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice