MYH9 (Myosin-9, Cellular Myosin Heavy Chain, Type A, Myosin Heavy Chain 9, Myosin Heavy Chain, Non-muscle IIa, Non-muscle Myosin Heavy Chain A, NMMHC-A, Non-muscle Myosin Heavy Chain IIa, NMMHC II-a, NMMHC-IIA)

Size

£639.00

SKU:: 130051
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1871-1960 from human MYH9 with GST tag. MW of the GST tag alone is 26kD. Species Sequence Homology: mouse
Clone:: 2B3
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: This gene encodes a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain. The protein is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in MYH9 are the cause of non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 0.5ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice