MYCL (MYCL1, v-Myc Myelocytomatosis Viral Oncogene Homolog 1 Lung Carcinoma Derived (Avian), Class E Basic Helix-loop-helix Protein 38, bHLHe38, LMYC, L-Myc, L-myc-1 Proto-oncogene Protein)

Size

£760.00

SKU:: 130044
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human MYCL1, aa1-206 (NP_005367.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: L-Myc is a nuclear protein with two molecular forms of 60 and 66kD and it plays a role in the control of cell growth, cell cycle progression, neoplasia, and apoptotic cell death. It contains a basic helix-loop-helix leucine zipper domain required for dimerization and binds DNA as an heterodimer with Max protein. Both molecular forms have been detected in some carcinoma cell lines. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.