MUC7 (Mucin-7, MUC-7, Apo-MG2, Salivary Mucin-7, MG2, Mucin 7, DKFZp686J03256, FLJ27047, MGC34772)

Size

£685.00

SKU:: 130004
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa36-135 from human MUC7 (NP_689504) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 7F2
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Applications: Suitable for use in ELISA and Western Blot Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. AA Sequence: HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.