MUC5B (Mucin-5B, MUC-5B, Cervical Mucin, High Molecular Weight Salivary Mucin MG1, Mucin-5 Subtype B, Tracheobronchial, Sublingual Gland Mucin, MUC5)

Size

£698.00

SKU:: 130003
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa4186-4296 from human MUC5B with GST tag. MW of the GST tag alone is 26kD.
Clone:: 8C11
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Gel-forming mucin that is thought to contribute to the lubricating and viscoelastic properties of whole saliva and cervical mucus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: CEEDSCQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHVDECGCTPFCVPAPMAPPHTRGFPAQEATAV* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.