129994-PE

MTSS1 (Metastasis Suppressor Protein 1, Missing In Metastasis Protein, Metastasis Suppressor YGL-1, KIAA0429, MIM) (PE)

Size

£914.00

SKU:: 129994-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa346-445 from MTSS1 (AAH23998) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G9
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Metastasis suppressor protein 1 (MTSS1) [MIM, "missing in metastasis"], was first discovered as missing transcripts from metastatic bladder and prostate cancer cells. MTSS1 is a 755aa protein, having multidomain and scaffolding function. It has a proline-rich/SH3 binding region and a serine-rich region with EGF or PDGF/Src consensus sites. It contains an actin-binding Wiskott-Aldrich syndrome protein homology-2 motif (WH2) at the C-terminus while the N-terminal IMD domain (IRSp53-MIM domain) interact with membranes and bundle actin filament. The WH2 domain binds to actin monomers and plays an important role in actin cytoskeleton reorganization. Recently, MIM was found to interact with cortactin via SH3 domains. In addition, MTSS1 enhanced cortactin- and Arp2/3-dependent actin polymerization. It is thus involved in cell motility and morphogenesis and also interacts with sonic hedgehog/Gli signaling in epidermal cells. MTSS1 acts as an important regulator of cell growth and development and is known to express in many tissues, including spleen, thymus, prostate, testis, uterus, colon, and peripheral blood. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GVLPAPPDGPEERGEHSPESPSVGEGPQGVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSPRDTPQ Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice