MTMR3 (Myotubularin-related Protein 3, FYVE Domain-containing Dual Specificity Protein Phosphatase 1, FYVE-DSP1, Zinc Finger FYVE Domain-containing Protein 10, KIAA0371, ZFYVE10, FLJ32333)

Size

£698.00

SKU:: 129981
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa579-674 from human MTMR3 (NP_066576) with GST tag.
Clone:: 1E11
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: Phosphatase that acts on lipids with a phosphoinositol headgroup. Has phosphatase activity towards phosphatidylinositol 3-phosphate and phosphatidylinositol 3,5-bisphosphate. May also dephosphorylate proteins phosphorylated on Ser, Thr, and Tyr residues. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.