129947-APC

MT2A (Metallothionein-2, MT-2, Metallothionein-2A, Metallothionein-II, MT-II, CES1, MT2) (APC)

Size

£927.00

SKU:: 129947-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-61 from human MT2A with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6G2
Format:: Supplied as a liquid in PBS, pH 7.4. Labeled with Allophycocyanin (APC).
Extra Details:: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. Applications: Suitable for use in FLISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.