MSX2 (Homeobox Protein MSX-2, Homeobox Protein Hox-8, HOX8)

Size

£685.00

SKU:: 129945
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa101-201 from human MSX2 (NP_002440) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Msx2 is a transcriptional repressor whose normal activity may establish a balance between survival and apoptosis of neural crest-derived cells required for proper craniofacial morphogenesis. This protein may also have a role in promoting cell growth under certain conditions and may be an important target for the RAS signaling pathways. Mutations in the Msx2 gene are associated with parietal foramina 1 and craniosynostosis type 2. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice