129942-BIOTIN
MSX1 (Homeobox Protein MSX-1, Homeobox Protein Hox-7, Msh Homeobox 1-like Protein, HOX7) (Biotin)
Size
£934.00
- SKU:
- 129942-BIOTIN
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human MSX1, aa1-297 (AAH67353.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- HOX7 is a 297aa novel member of homeodomain family of DNA binding domain family (meta HOX) that functions as a DNA-associated transcription factor. It has a helix-turn-helix and DNA binding domain. It plays an important role in inhibiting MYOD1 expression and is involved in epithelial-mesenchymal signaling in many organs, playing a role in limb-pattern formation. It acts as a potential repressor in cell cycle progression and as a RNA polymerase 2 transcription factor, involved in skeletal development. Northern blot analysis detects highest expression of HOX7 in heart along with other tissues like prostate and highly in dental mesenchyme during critical bud stage, placenta, etc. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice