MSMB (Beta-microseminoprotein, PSP-94, Immunoglobulin-binding Factor, IGBF, PN44, Prostate Secreted Seminal Plasma Protein, Prostate Secretory Protein of 94 Amino Acids, PSP94, Seminal Plasma beta-inhibin, PRSP)

Size

£685.00

SKU:: 129934
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-114 from human MSMB (AAH05257.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.