129920-ML650
MSH6 (DNA Mismatch Repair Protein Msh6, hMSH6, G/T Mismatch-binding Protein, GTBP, GTMBP, MutS-alpha 160kD Subunit, p160, GTBP) (MaxLight 650)
Size
£914.00
- SKU:
- 129920-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa931-1030 from human MSH6 (NP_000170) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1F2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. The MSH6 gene located on chromosome 2p16 is one of the mismatch-repair genes involved in hereditary nonpolyposis colorectal cancer (HNPCC). It performs other functions in the cell, like binding to damaged DNA to initiate events that result in damage-induced cytotoxicity. It shares five conserved protein domains (designated I-V) in common with bacterial MutS. However unlike bacterial MutS or Msh2, Msh6 has an additional evolutionarily conserved region preceding domain I, comprised of from 100-more than 600aa, depending on the organism. These N-Terminal Regions (NTRs) of Msh6 contain short, conserved PIP (PCNA interacting protein) boxes near the N-terminus that interact with PCNA, the sliding clamp that participates in both DNA replication and DNA mismatch repair. It forms a heterodimer with MSH2 and is also a part of the BRCA1-associated genome surveillance complex (BASC). The pathological role of Msh6 has also been identified in endometrial cancer. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AGFDSDYDQALADIRENEQSLLEYLEKQRNRIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEERRDVSLK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice