129918
MSH2 (DNA Mismatch Repair Protein Msh2, hMSH2, MutS Protein Homolog 2)
Size
£685.00
- SKU:
- 129918
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa835-934 from human MSH2 with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4B2
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Extra Details:
- MSH2 is a member of the highly conserved families of postreplication mismatch repair genes, MutS and MaiL, involved in increasing the fidelity of replication by specific repair of DNA polymerase misincorporation errors. It is the human homolog of the bacterial MutS and S. cerevisiae MSH proteins. It maps to human chromosome 2p22-21 near a locus implicated in hereditary nonpolyposis colon cancer (HNPCC) and thus is the HNPCC gene. Defects in MSH2 accounts for most cases of sporadic colorectal tumors. Due to other functions besides its role in DNA repair, that include regulation of cell proliferation and apoptosis, it has recently been shown to be of importance for pathogenesis and progression of cancer. It is ubiquitously expressed. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice