MRS2 (Magnesium Transporter MRS2 Homolog, Mitochondrial, MRS2-like Protein, HPT, MRS2L, MGC78523)

Size

£685.00

SKU:: 129900
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-118 from human MRS2L with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1E2
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: MRS2 is magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MECLRSLPCLLPRAMRLPRRTLCALALDVTSVGPPVAACGRRANLIGRSRAAQLCGPDRLRVAGEVHRFRTSDVSQATLASVAPVFTVTKFDKQGNVTSFVFESCDNSRVSSDIRLS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.