MRLC2 (MYL12B, MYLC2B, Myosin Regulatory Light Chain 12B, MLC-2A, Myosin Regulatory Light Chain 2-B, Smooth Muscle Isoform, Myosin Regulatory Light Chain 20kD, Myosin Regulatory Light Chain MRLC2, SHUJUN-1)

Size

£685.00

SKU:: 129851
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa73-173 from human MRLC2 (NP_291024) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B22
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]). Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.