129842-ML650
MRC1 (Macrophage Mannose Receptor 1, MMR, C-type Lectin Domain Family 13 Member D, C-type Lectin Domain Family 13 Member D-like, Macrophage Mannose Receptor 1-like Protein 1, CD206, CLEC13D, CLEC13DL, MRC1L1) (MaxLight 650)
Size
£914.00
- SKU:
- 129842-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa22-130 from human MRC1 (NP_002429) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5C11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. MMR, also known as CD206 and MRC1, is a 17kD scavenger receptor that belongs to the C-type lectin protein family. MMR is expressed on tissue macrophages, myeloid dendritic cells, and liver and lymphatic endothelial cells. The extracellular region of MMR is composed of an N-terminal cysteine-rich domain, one fibronectin type II repeat, and eight C-type lectin carbohydrate recognition domains. MMR mediates the phagocytosis of sulfated N-acetylgalactosamine-containing molecules including those found on a variety of microorganisms. Within the extracellular region, mouse MMR shares 83% and 92% aa sequence identity with human and rat MMR. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice