129842-FITC

MRC1 (Macrophage Mannose Receptor 1, MMR, C-type Lectin Domain Family 13 Member D, C-type Lectin Domain Family 13 Member D-like, Macrophage Mannose Receptor 1-like Protein 1, CD206, CLEC13D, CLEC13DL, MRC1L1) (FITC)

Size

£914.00

SKU:: 129842-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-130 from human MRC1 (NP_002429) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: MMR, also known as CD206 and MRC1, is a 17kD scavenger receptor that belongs to the C-type lectin protein family. MMR is expressed on tissue macrophages, myeloid dendritic cells, and liver and lymphatic endothelial cells. The extracellular region of MMR is composed of an N-terminal cysteine-rich domain, one fibronectin type II repeat, and eight C-type lectin carbohydrate recognition domains. MMR mediates the phagocytosis of sulfated N-acetylgalactosamine-containing molecules including those found on a variety of microorganisms. Within the extracellular region, mouse MMR shares 83% and 92% aa sequence identity with human and rat MMR. Applications: Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice