129842-BIOTIN

MRC1 (Macrophage Mannose Receptor 1, MMR, C-type Lectin Domain Family 13 Member D, C-type Lectin Domain Family 13 Member D-like, Macrophage Mannose Receptor 1-like Protein 1, CD206, CLEC13D, CLEC13DL, MRC1L1) (Biotin)

Size

£914.00

SKU:: 129842-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-130 from human MRC1 (NP_002429) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5C11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: MMR, also known as CD206 and MRC1, is a 17kD scavenger receptor that belongs to the C-type lectin protein family. MMR is expressed on tissue macrophages, myeloid dendritic cells, and liver and lymphatic endothelial cells. The extracellular region of MMR is composed of an N-terminal cysteine-rich domain, one fibronectin type II repeat, and eight C-type lectin carbohydrate recognition domains. MMR mediates the phagocytosis of sulfated N-acetylgalactosamine-containing molecules including those found on a variety of microorganisms. Within the extracellular region, mouse MMR shares 83% and 92% aa sequence identity with human and rat MMR. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: TRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRWVSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYGNRQEKNIMLY Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice