MPPED2 (Metallophosphoesterase MPPED2, Fetal Brain Protein 239, 239FB, Metallophosphoesterase Domain-containing Protein 2, C11orf8, FAM1B)

Size

£760.00

SKU:: 129828
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human MPPED2, aa1-294 (NP_001575.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: MMPED2 (Metallophosphoesterase domain containing 2) displays low metallophosphoesterase activity (in vitro). It is predominantly expressed in the fetal brain and is thought to have a role in development of the nervous system. Alternatively spliced transcript variants have been described. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.