129798
Mortality Factor 4 (MORF4, CSR, SEN, CSRB, SEN1)
Size
£685.00
- SKU:
- 129798
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human MORF4, aa1-235 (NP_006783.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Mortality Factor 4 (MORF4), known also as SEN1 and cellular senescence-related protein 1. MORF4 is a nuclear localized protein possessing transcription factor-like motifs such as helix-loop-helix and a leucine zipper motif that are believed to allow it to form transcriptionally active homo- or heterodimers. MORF4 has been shown to bind to the transcription co-repressors mSin3A and TLE, suggesting that together, these complexes may play a role in transcriptional repression of genes that lead to cellular senescence. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MRWAAPGKKTSGLQQKNIEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRAQVDPTVENEETFMNRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAEKNVDSILEDYANYKKSHGNTDNKEYAVNEVVAGIKEYFNLMLGTQLLNKFERPQYAEILADCPDAPMSQVYGVPHLLRLSVQIGAMLAYTPLNEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVALPEYHRKAV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice