129791-BIOTIN

MOGAT3 (2-acylglycerol O-acyltransferase 3, Acyl-CoA:monoacylglycerol Acyltransferase 3, MGAT3, Diacylglycerol O-acyltransferase Candidate 7, hDC7, Diacylglycerol Acyltransferase 2-like Protein 7, Monoacylglycerol O-acyltransferase 3, DC7, DGAT2L7, UNQ9383/PRO34208, MGC119203, MGC119204) (Biotin)

Size

£914.00

SKU:: 129791-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa59-108 from human MOGAT3 (NP_835470) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F7
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Also able to catalyze the terminal step in triacylglycerol synthesis by using diacylglycerol and fatty acyl-CoA as substrates. Has a preference toward palmitoyl-CoA and oleoyl-CoA. May be involved in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Sandwich ELISA: The detection limit is ~10ng/ml as a capture antibody Optimal dilutions to be determined by the researcher. Amino Acid Sequence: YLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDR* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice