MMRN1 (ECM, EMILIN4, GPIA, MMRN, Multimerin-1, EMILIN-4, Elastin Microfibril Interface Located Protein 4, Endothelial Cell Multimerin, Platelet Glycoprotein Ia, 155kD Platelet Multimerin)

Size

£685.00

SKU:: 129771
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa291-391 from MMRN1 (NP_031377) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4B9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Multimerin is a massive, soluble protein found in platelets and in the endothelium of blood vessels. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. Multimerin is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. It may also have functions as an extracellular matrix or adhesive protein. Recently, patients with an unusual autosomal-dominant bleeding disorder (factor V Quebec) were found to have a deficiency of platelet multimerin. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNISLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDI* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

MMRN1 (ECM, EMILIN4, GPIA*, MMRN, Multimerin-1, EMILIN-4, Elastin Microfibril Interface Located Protein 4, Endothelial Cell Multimerin, Platelet Glycoprotein Ia*, 155kD Platelet Multimerin)