MMP23B (Matrix Metalloproteinase-23, MMP-23, Femalysin, MIFR-1, Matrix Metalloproteinase-21, MMP-21, Matrix Metalloproteinase-22, MMP-22, MMP23A, MMP21, MMP23B, MMP22)

Size

£685.00

SKU:: 129756
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa241-340 from human MMP23B with GST tag. MW of the GST tag alone is 26kD.
Clone:: 200
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: MMP23A and MMP23B, two Metallopeptidase type proteases, are type II membrane-anchored zymogens that are proteolytically processed at a conserved motif and converted into secretory and mature enzymes. The proteins contain prepro, catalytic, cysteine-rich, interleukin-1 receptor-related and proline-rich domains. The MMP23A and MMP23B genes have been reported to express multiple mRNAs, some of which are derived by alternative splicing. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.