129756-FITC
MMP23B (Matrix Metalloproteinase-23, MMP-23, Femalysin, MIFR-1, Matrix Metalloproteinase-21, MMP-21, Matrix Metalloproteinase-22, MMP-22, MMP23A, MMP21, MMP23B, MMP22) (FITC)
Size
£914.00
- SKU:
- 129756-FITC
- Application:
- FLISA
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa241-340 from human MMP23B with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 200
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- MMP23A and MMP23B, two Metallopeptidase type proteases, are type II membrane-anchored zymogens that are proteolytically processed at a conserved motif and converted into secretory and mature enzymes. The proteins contain prepro, catalytic, cysteine-rich, interleukin-1 receptor-related and proline-rich domains. The MMP23A and MMP23B genes have been reported to express multiple mRNAs, some of which are derived by alternative splicing. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEP* Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice