MLLT6 (Protein AF-17, ALL1-fused Gene from Chromosome 17 Protein, AF17, FLJ23480)

Size

£685.00

SKU:: 129729
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-462 from human MLLT6 (AAH07237) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Band 11q23 chromosome locations are associated with approximately 10% of patients with acute lymphoblastic leukemia (ALL) and more than 5% of patients with acute myeloid leukemia (AML). 11q23 translocation associated leukemias typically jointly express lymphoid and myeloid markers and exhibit poor prognosis. The gene at 11q23 involved in the translocations is known by multiple names, including ALL1, HRX, MLL, and TRX1. One of the more infrequent translocations, t(11;17)(q23;q21), MLLT6, encodes a protein of 1,093aa, containing a leucine-zipper dimerization motif 3-prime to the fusion point and a cysteine-rich domain at the end terminus that can be arranged in 3 zinc fingers. MMLT6 contains amino acid runs associated with domains involved in transcriptional repression or activation. It has been proposed that MLLT6 represses truncated ALL1 function or inhibits function of the normal protein in leukemic cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGAVNPLLSQAESSHTEPDLEDCSFRCRGTSPQESLSSMSPISSLPALFDQTASAPCGGGQLDPAAPGTTNMEQLLEKQGDGEAGVNIVEMLKALHALQKENQRLQEQILSLTAKKERLQILNVQLSVPFPALPAALPAANGPVPGPYGLPPQAGSSDSLSTSKSPPGKSSLGLDNSLSTSSEDPHSGCPSRSSSSLSFHSTPPPLPLLQQSPATLPLALPGAPAPLPPQPQNGLGRAPGAAGLGAMPMAEGLLGGLAGSGGLPLNGLLGGLNGAAAPNPASLSQAGGAPTLQLPGCLNSLTEQQRHLLQQQEQQLQQLQQLLASPQLTPEHQTVVYQMIQQIQQKRELQRLQMAGGSQLPMASLLAGSSTPLLSAGTPGLLPTASAPPLLPAGALVAPSLGNNTSLMAAAAAAAAVAAAGGPPVLTAQTNPFLSLSGAEGSGGGPKGGTADKGASANQEKG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice