MLLT1 (ENL, LTG19, YEATS1, Protein ENL, YEATS Domain-containing Protein 1)

Size

£685.00

SKU:: 129726
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa472-559 from human MLLT1 (NP_005925) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3H2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Chromosome band 11q23 is the site of translocations in myeloid and lymphoid acute leukemias, pediatric leukemias, and treatment-induced secondary acute myelogenous leukemia. The translocation breakpoints cluster in a restricted region of the HRX gene resulting in chimeric genes that encode an N-terminal portion of Hrx fused to various partner proteins. Myeloid/lymphoid or mixed-lineage leukemia translocated to 1 (MLLT1) is a nuclear protein with transcriptional transactivation properties that is fused to Hrx in t(11;19) leukemias. The minimal MLLT1 sequence required for transcription activation was narrowed to the C-terminal 90 amino acids. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice