129726-BIOTIN
MLLT1 (ENL, LTG19, YEATS1, Protein ENL, YEATS Domain-containing Protein 1) (Biotin)
Size
£914.00
- SKU:
- 129726-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa472-559 from human MLLT1 (NP_005925) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3H2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Chromosome band 11q23 is the site of translocations in myeloid and lymphoid acute leukemias, pediatric leukemias, and treatment-induced secondary acute myelogenous leukemia. The translocation breakpoints cluster in a restricted region of the HRX gene resulting in chimeric genes that encode an N-terminal portion of Hrx fused to various partner proteins. Myeloid/lymphoid or mixed-lineage leukemia translocated to 1 (MLLT1) is a nuclear protein with transcriptional transactivation properties that is fused to Hrx in t(11;19) leukemias. The minimal MLLT1 sequence required for transcription activation was narrowed to the C-terminal 90 amino acids. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: GRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice