MLL4 (Histone-lysine N-methyltransferase MLL4, Lysine N-methyltransferase 2D, KMT2D, Myeloid/Lymphoid or Mixed-lineage Leukemia Protein 4 Trithorax Homolog 2, WW Domain-binding Protein 7, WBP-7, WBP7, HRX2, KIAA0304, KMT2D, MLL2, TRX2)

Size

£685.00

SKU:: 129723
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa813-905 from MLL4 (NP_055542) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: MLL4 contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.