129713
MLF1 (Myeloid Leukemia Factor 1, Myelodysplasia-myeloid Leukemia Factor 1)
Size
£685.00
- SKU:
- 129713
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human MLF1, aa1-268 (NP_071888.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. The protein interferes with erythopoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. It suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. It binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice