MKRN3 (D15S9, RNF63, ZNF127, Probable E3 Ubiquitin-protein Ligase Makorin-3, RING Finger Protein 63, Zinc Finger Protein 127, MGC88288)

Size

£685.00

SKU:: 129712
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa437-508 from human MKRN3 (NP_005655) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2E10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: The protein encoded by this gene contains a RING (C3HC4) zinc finger motif and several C3H zinc finger motifs. Applications: Suitable for use in ELISA and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLASLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLIL* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.