MKRN1 (E3 Ubiquitin-protein Ligase Makorin-1, RING Finger Protein 61, RNF61)

Size

£685.00

SKU:: 129707
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa365-441 from MKRN1 (NP_038474) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4E9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: MKRN1 (Makorin ring finger protein 1) is a a ubiquitously expressed novel RING zinc finger protein, a member of the Makorin family of proteins. The MKRN gene family encodes putative ribonucleoproteins with a distinctive array of zinc finger motifs, including two to four C(3)H zinc fingers, an unusual Cys/His arrangement that may represent a novel zinc finger structure, and a highly conserved RING zinc finger. So far, nine MKRN family loci have been found distributed throughout the human genome. The MKRN1 gene is highly transcribed in mammals. The MKRN1 protein has been shown to act as an E3 ubiquitin ligase and may represent a nuclear protein with multiple nuclear functions, including the regulation of RNA polymerase II catalyzed transcription. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVV* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice