129707-APC
MKRN1 (E3 Ubiquitin-protein Ligase Makorin-1, RING Finger Protein 61, RNF61) (APC)
Size
£927.00
- SKU:
- 129707-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa365-441 from MKRN1 (NP_038474) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4E9
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- MKRN1 (Makorin ring finger protein 1) is a a ubiquitously expressed novel RING zinc finger protein, a member of the Makorin family of proteins. The MKRN gene family encodes putative ribonucleoproteins with a distinctive array of zinc finger motifs, including two to four C(3)H zinc fingers, an unusual Cys/His arrangement that may represent a novel zinc finger structure, and a highly conserved RING zinc finger. So far, nine MKRN family loci have been found distributed throughout the human genome. The MKRN1 gene is highly transcribed in mammals. The MKRN1 protein has been shown to act as an E3 ubiquitin ligase and may represent a nuclear protein with multiple nuclear functions, including the regulation of RNA polymerase II catalyzed transcription. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNPFDNDEEEVV* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice