129692-HRP
MIF (Macrophage Migration Inhibitory Factor, Glycosylation-inhibiting Factor, GIF, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase, GLIF, MMIF) (HRP)
Size
£914.00
- SKU:
- 129692-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length recombinant corresponding to aa1-115 from human MIF (AAH00447.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2A10-4D3
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- MIF (macrophage migration inhibitory factor) was one of the first cytokine activities to be discovered and was initially described as a T cell-derived factor that inhibit the random migration of microphages. Recently, MIF was rediscovered as a pituitary hormone that acts as the counter-regulatory hormone for glucocorticoid action within the immune system. MIF was released from macrophages and T-cells in response to physiological concentrations of glucocorticoids. The secreted MIF counter-regulates the immunosuppressive effects of steroids on immune cell activation and cytokine production. MIF also plays a critical role in the host control of inflammation and immunity. Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 1-10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice