129680-APC

b2-Microglobulin (B2M, Beta-2-microglobulin) (APC)

Size

£934.00

SKU:: 129680-APC
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human B2M, aa1-119 (NP_004039.1).
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Beta-2-microglobulin is a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.