MIB2 (E3 Ubiquitin-protein Ligase MIB2, Mind Bomb Homolog 2, Novel Zinc Finger Protein, Novelzin, Putative NF-kappa-B-activating Protein 002N, Skeletrophin, Zinc Finger ZZ Type with Ankyrin Repeat Domain Protein 1, SKD, ZZANK1, FLJ20648, FLJ39787, ZZZ5)

Size

£698.00

SKU:: 129673
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa381-481 from human MIB2 (AAH37542) with GST tag.
Clone:: 1B5
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.