KXD1 (KxDL Motif-containing Protein 1, C19orf50, DKFZp686B1038, FLJ25480, FLJ43375, MGC2749, MST096, MSTP096, UPF0459 Protein C19orf50)

Size

£685.00

SKU:: 129632
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa81-177 from human MGC2749 (NP_076974) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4C9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Involved in endosomal cargo sorting. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.