MGAT4B (Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, GlcNAc-T IVb, GnT-IVb, N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVb, UNQ906/PRO1927)

Size

£685.00

SKU:: 129621
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to amino acids 401-501 of MGAT4B (NP_055090) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F4
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Has lower affinities for donors or acceptors than MGAT4A, suggesting that, under physiological conditions, it is not the main contributor in N-glycan biosynthesis. Applications: Suitable for use in ELISA, Immunocytochemistry/Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AEVSTSLKTYQHFTLEKAYLREDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTATLRYPRSPDGY* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice