MFNG (Beta-1,3-N-acetylglucosaminyltransferase Manic Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase)

Size

£685.00

SKU:: 129612
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa214-291 from human MFNG (NP_002396) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: MFNG is a 52-55kD member of the glucosyltransferase 31 family. It is a Golgi membrane protein that transfers N-acetylglucosamine to an O-linked fucose residue on Notch. Activity on Notch increases Delta-1 induced signaling while suppressing Jagged-1 signaling. MFNG is found in fetal pancreatic endocrine progenitor cells and immature ventricular zone neurons. Human MFNG is a 321aa type II transmembrane protein. It contains a short 7aa cytoplasmic region, plus a 294aa luminal domain (aa28-321). There are two potential splice variants, one that shows a 15aa substitution for aa104-321, and another that contains a three aa substitution for aa86-102. Over aa37-321, human MFNG shares 85% aa identity with mouse MFNG. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice