129612-ML550
MFNG (Beta-1,3-N-acetylglucosaminyltransferase Manic Fringe, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) (MaxLight 550)
Size
£914.00
- SKU:
- 129612-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa214-291 from human MFNG (NP_002396) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2B11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. MFNG is a 52-55kD member of the glucosyltransferase 31 family. It is a Golgi membrane protein that transfers N-acetylglucosamine to an O-linked fucose residue on Notch. Activity on Notch increases Delta-1 induced signaling while suppressing Jagged-1 signaling. MFNG is found in fetal pancreatic endocrine progenitor cells and immature ventricular zone neurons. Human MFNG is a 321aa type II transmembrane protein. It contains a short 7aa cytoplasmic region, plus a 294aa luminal domain (aa28-321). There are two potential splice variants, one that shows a 15aa substitution for aa104-321, and another that contains a three aa substitution for aa86-102. Over aa37-321, human MFNG shares 85% aa identity with mouse MFNG. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice