129603-BIOTIN
MFAP4 (Microfibril-associated Glycoprotein 4) (Biotin)
Size
£914.00
- SKU:
- 129603-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa23-122 from human MFAP4 (NP_002395) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3A5
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- Microfibril-associated protein 4 (MFAP4) was initially identified as a gene commonly deleted in the contiguous Smith-Magenis syndrome (SMS) gene. MFAP4 was identified as growth factor to support expansion of hematopoietic stem cells in culture. It is involved in calcium-dependent cell adhesion and intercellular interactions. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice