129603-APC

MFAP4 (Microfibril-associated Glycoprotein 4) (APC)

Size

£927.00

SKU:: 129603-APC
Application:: FLISA
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa23-122 from human MFAP4 (NP_002395) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3A5
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Microfibril-associated protein 4 (MFAP4) was initially identified as a gene commonly deleted in the contiguous Smith-Magenis syndrome (SMS) gene. MFAP4 was identified as growth factor to support expansion of hematopoietic stem cells in culture. It is involved in calcium-dependent cell adhesion and intercellular interactions. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.