129578-PE

MELK (Maternal Embryonic Leucine Zipper Kinase, hMELK, Protein Kinase PK38, hPK38, KIAA0175) (PE)

Size

£914.00

SKU:: 129578-PE
Application:: FLISA
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa550-650 from MELK (AAH14039) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Maternal embryonic leucine zipper kinase (MELK) is a member of the Snf1/AMPK serine/threonine kinase family. Members of this family provide protection to cells against environmental stress and may control biosynthetic pathways of carbon metabolism. MELK is expressed in a spatially and temporally specific pattern during mammalian embryogenesis. The strongest expression was detected during maturation of oocytes and preimplantation development. Studies also indicated that MELK functions as a cancer-specific protein kinase, and down-regulation of MELK results in growth suppression of breast cancer cells. In addition, it was demonstrated that MELK physically interacts and phosphorylates a long isoform of Bcl-G (Bcl-GL), a pro- apoptotic member of the Bcl-2 family, to affect mammary carcinogenesis through inhibition of the pro-apoptotic function of Bcl-GL. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice