129578-BIOTIN

MELK (Maternal Embryonic Leucine Zipper Kinase, hMELK, Protein Kinase PK38, hPK38, KIAA0175) (Biotin)

Size

£914.00

SKU:: 129578-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa550-650 from human MELK with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Maternal embryonic leucine zipper kinase (MELK) is a member of the Snf1/AMPK serine/threonine kinase family. Members of this family provide protection to cells against environmental stress and may control biosynthetic pathways of carbon metabolism. MELK is expressed in a spatially and temporally specific pattern during mammalian embryogenesis. The strongest expression was detected during maturation of oocytes and preimplantation development. Studies also indicated that MELK functions as a cancer-specific protein kinase, and down-regulation of MELK results in growth suppression of breast cancer cells. In addition, it was demonstrated that MELK physically interacts and phosphorylates a long isoform of Bcl-G (Bcl-GL), a pro- apoptotic member of the Bcl-2 family, to affect mammary carcinogenesis through inhibition of the pro-apoptotic function of Bcl-GL. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice