MEKK3 (MAPK/ERK Kinase Kinase 3, MEK Kinase 3, MEKK 3, Mitogen-activated Protein Kinase Kinase Kinase 3, MAP3K3, MAPKKK3)

Size

£685.00

SKU:: 129571
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-89 from human MAP3K3 (AAH10464) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1H3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: MEKK3 directly regulates the stress-activated protein kinase (SAPK) and extracellular signal-regulated protein kinase (ERK) pathways by activating SEK and MEK1/2 respectively; it does not regulate the p38 pathway. In cotransfection assays, it enhances transcription from a nuclear factor kappa-B (NFKB)-dependent reporter gene, consistent with a role in the SAPK pathway. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNEANVMLPYSGKEEPVLPVAMTLPLPGRGPRCGTAATEGGSSFVNAVVSVLQVGVTLMLYPVSKLETVCALWALSTPALGLGLGCIEK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.