129555
MEF2A (Myocyte-specific Enhancer Factor 2A, Serum Response Factor-like Protein 1, MEF2)
Size
£685.00
- SKU:
- 129555
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa71-170 from human MEF2A (AAH13437) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1A10
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- MEF2A is a member of the myocyte enhancer factor-2 (MEF2) family of transcription factors, and other members include MEF2B, MEF2C and MEF2D. These DNA-binding proteins are important transcription factors in both the maintenance and induction of the muscle differentiated phenotype. These factors bind DNA as homo- and heterodimers but can also form protein-protein interactions with the thyroid hormone receptor. MEF2A was initially identified as a muscle-specific gene, but was later shown to be highly expressed in the endothelium of coronary arteries. Human MEF2A gene is located in chromosomal 15q26 region. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNFSMSVTVPVTSPNALSYTNPGSSLVSPSLAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice