129546-FITC

MED4 (ARC36, DRIP36, VDRIP, Mediator of RNA Polymerase II Transcription Subunit 4, Activator-recruited Cofactor 36kD Component, Mediator Complex Subunit 4, TRAP/SMCC/PC2 Subunit p36 Subunit, Vitamin D3 Receptor-interacting Protein Complex 36kD Component) (FITC)

Size

£914.00

SKU:: 129546-FITC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-271 from human MED4 (AAH05189) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2B10
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Extra Details:: The Mediator is a multiprotein coactivator that is required by DNA-binding transcription factors for activation of polymerase II (see MIM 180660)-transcribed genes. MED4 appears to be a core Mediator subunit and is found in nearly all Mediator preparations (summary by Sato et al., 2004 [PubMed 15175163]). Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDV Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice